Recombinant Mouse Prox1

Recombinant Mouse PROX1

Catalog No.：BH-D0234

Sequence Information

Species：Mouse                                                   Gene ID:19130

Residues:Gly560-Leu735                                      Synonyms:PROX1

GDLQDMSDISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFN

RCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNM

HYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEV

PEIFKSPNCLQELL

Product Information

Source: Recombinant expression.

Host: E.coli

Tags: N-terminal His Tag

Subcellular Location: Nucleus.

Purity: >90%

Traits: Freeze-dried powder

Buffer formulation: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and

Proclin300.

Original Concentration: 200µg/mL

Applications: Positive Control; Immunogen; SDS-PAGE; WB.

(May be suitable for use in other assays to be determined by the end user.)

Predicted isoelectric point: 6.5

Predicted Molecular Mass: 24.0kDa

Accurate Molecular Mass: 24kDa as determined by SDS-PAGE reducing conditions.

tion date under appropriate storage condition.

[ USAGE ]

Storage: Avoid repeated freeze/thaw cycles.

Store at 2-8oC for one month.

Aliquot and store at -80oC for 12 months.

Stability Test: The thermal stability is described by the loss rate. The loss rate was

determined by accelerated thermal degradation test, that is, incubate the protein at 37oC

for 48h, and no obvious degradation and precipitation were observed. The loss rate is

less than 5% within the expiration date under appropriate storage condition.

[ IDENTIFICATION]

Figure 1. SDS-PAGE

[ IMPORTANT NOTE ]

The kit is designed for in vitro and research use only, we will not be responsible for any

issue if the kit was used in clinical diagnostic or any other procedures.